Structure of PDB 2ykr Chain E

Receptor sequence

>2ykrE (length=150) Species: 668369 (Escherichia coli DH5[alpha])

ELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAA
IQKAMEKARRNMINVALNNGTLQHPVKGVHTGSRVFMQPASEGTGIIAGG
AMRAVLEVAGVHNVLAKAYGSTNPINVVRATIDGLENMNSPEMVAAKRGK

3D structure

• PDB: 2ykr Structural Basis for the Function of a Small Gtpase Rsga on the 30S Ribosomal Subunit Maturation Revealed by Cryoelectron Microscopy.
• Chain: E
• Resolution: 9.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	E	R19 V20 S21 K22 T23 K25 G27 R28 F30 T33 Y49 K51 A52 R53 K61 H88 T89 G90 R92 Q96 A98 T102 G103 I104 I105 A106 G107 M110 L123 A124 K125 A126 Y127 G128 T130 N131 I133 N134 R137	R11 V12 S13 K14 T15 K17 G19 R20 F22 T25 Y41 K43 A44 R45 K53 H80 T81 G82 R84 Q88 A90 T94 G95 I96 I97 A98 G99 M102 L115 A116 K117 A118 Y119 G120 T122 N123 I125 N126 R129

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding
• GO:0019843 rRNA binding

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0046677 response to antibiotic
• GO:1990145 maintenance of translational fidelity

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:2ykr, PDBe:2ykr, PDBj:2ykr
• PDBsum: 2ykr
• PubMed: 21788480
• UniProt: P0A7W1|RS5_ECOLI Small ribosomal subunit protein uS5 (Gene Name=rpsE)