Structure of PDB 2xm3 Chain E

Receptor sequence

>2xm3E (length=126) Species: 1299 (Deinococcus radiodurans)

EMKKGRGYVYQLEYHLIWCVKYRHQVLVGEVADGLKDILRDIAAQNGLEV
ITMEVMPDHVHLLLSATPQQAIPDFVKALKGASARRMFVAYPQLKEKLWG
GNLWNPSYCILTVSENTRAQIQKYIE

3D structure

• PDB: 2xm3 DNA Recognition and the Precleavage State During Single-Stranded DNA Transposition in D. Radiodurans.
• Chain: E
• Resolution: 2.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	E	K29 Y30 P81 V84 K85 K88 G89 A90 A92 R93 F96 G109 N110 L111 W112 N113 P114 S115 Y116	K21 Y22 P73 V76 K77 K80 G81 A82 A84 R85 F88 G101 N102 L103 W104 N105 P106 S107 Y108
BS02	dna	E	Y30 R31 H32 K105 L106 W107	Y22 R23 H24 K97 L98 W99
BS03	dna	E	K12 R14 Y16 Q77	K4 R6 Y8 Q69
BS04	dna	E	Y132 I133	Y124 I125

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0004519 endonuclease activity
• GO:0004803 transposase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006310 DNA recombination
• GO:0006313 DNA transposition
• GO:0032196 transposition

External links

• PDB: RCSB:2xm3, PDBe:2xm3, PDBj:2xm3
• PDBsum: 2xm3
• PubMed: 20890269
• UniProt: Q7DF83|DRA2A_DEIRA ISDra2 transposase TnpA (Gene Name=tnpA)