Structure of PDB 2xjz Chain E

Receptor sequence

>2xjzE (length=127) Species: 9606 (Homo sapiens) [Search protein sequence]

CGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKL
CRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHF
CVGDRYLLINSDIVCEQDIYEWTKING

3D structure

PDB

2xjz Structure of the Leukemia Oncogene Lmo2: Implications for the Assembly of a Hematopoietic Transcription Factor Complex.

Chain

Resolution

2.8 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	E	F35 L36 K37 E45 R63 L64 Y65 Y66 K67 R74 Y77 L78 Q83 D84 G85 A96 E98 M99 T100 M101 R102 C123 V124 G125 D126 R127 Y128 L129	F13 L14 K15 E23 R41 L42 Y43 Y44 K45 R52 Y55 L56 Q61 D62 G63 A74 E76 M77 T78 M79 R80 C101 V102 G103 D104 R105 Y106 L107
BS02	ZN	E	C115 C137 D140	C93 C115 D118
BS03	ZN	E	C87 C90 H109 C112	C65 C68 H87 C90
BS04	ZN	E	C50 C53 C73 D76	C28 C31 C51 D54
BS05	ZN	E	C23 C26 C47	C1 C4 C25

External links

PDB	RCSB:2xjz, PDBe:2xjz, PDBj:2xjz
PDBsum	2xjz
PubMed	21076045
UniProt	P25791\|RBTN2_HUMAN Rhombotin-2 (Gene Name=LMO2)