Structure of PDB 2v9j Chain E

Receptor sequence

>2v9jE (length=304) Species: 10116 (Rattus norvegicus)

SNSSVYTTFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAP
LWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQ
DSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRIL
KFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQH
RVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYF
EGVLKCYLHETLEAIINRLVEAEVHRLVVVDEHDVVKGIVSLSDILQALV
LTGG

3D structure

• PDB: 2v9j Structural Basis for AMP Binding to Mammalian AMP-Activated Protein Kinase
• Chain: E
• Resolution: 2.53 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ATP	E	R69 K169 I239 S241 F243 D244 F272 V275 L276 V296 H297 R298	R47 K147 I217 S219 F221 D222 F250 V253 L254 V274 H275 R276
BS02	ATP	E	M84 T86 T88 D89 L128 V129 I149 H150 R151 S225	M62 T64 T66 D67 L106 V107 I127 H128 R129 S203
BS03	AMP	E	T199 I203 A204 V224 S225 H297 I311 S313 D316	T177 I181 A182 V202 S203 H275 I289 S291 D294

Gene Ontology

Molecular Function

• GO:0004672 protein kinase activity
• GO:0004679 AMP-activated protein kinase activity
• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0016208 AMP binding
• GO:0019887 protein kinase regulator activity
• GO:0019901 protein kinase binding
• GO:0043531 ADP binding
• GO:0044877 protein-containing complex binding

Biological Process

• GO:0006633 fatty acid biosynthetic process
• GO:0010628 positive regulation of gene expression
• GO:0031669 cellular response to nutrient levels
• GO:0051170 import into nucleus

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0031588 nucleotide-activated protein kinase complex
• GO:0032991 protein-containing complex

External links

• PDB: RCSB:2v9j, PDBe:2v9j, PDBj:2v9j
• PDBsum: 2v9j
• PubMed: 17851531
• UniProt: P80385|AAKG1_RAT 5'-AMP-activated protein kinase subunit gamma-1 (Gene Name=Prkag1)