Structure of PDB 2qrw Chain E

Receptor sequence
>2qrwE (length=126) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence]
KSFYDAVGGAKTFDAIVSRFYAQVAEDEVLRRVYPEDDLAGAEERLRMFL
EQYWGGPRTYSEQRGHPRLRMRHAPFRISLIERDAFLRCMHTAVASIDSE
TLDDEHRRELLDYLEMAAHSLVNSPF
3D structure
PDB2qrw The Roles of Tyr(CD1) and Trp(G8) in Mycobacterium tuberculosis Truncated Hemoglobin O in Ligand Binding and on the Heme Distal Site Architecture
ChainE
Resolution1.93 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 HEM E Y36 P37 R47 L48 F51 Y62 R66 L71 R74 H75 F78 I80 F88 Y115 A119 A120 L123 Y34 P35 R45 L46 F49 Y60 R64 L69 R72 H73 F76 I78 F86 Y113 A117 A118 L121
Gene Ontology
Molecular Function
GO:0005344 oxygen carrier activity
GO:0005515 protein binding
GO:0008941 nitric oxide dioxygenase NAD(P)H activity
GO:0019825 oxygen binding
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0015671 oxygen transport
GO:0051410 detoxification of nitrogen compound
Cellular Component
GO:0005886 plasma membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:2qrw, PDBe:2qrw, PDBj:2qrw
PDBsum2qrw
PubMed17887774
UniProtP9WN23|TRHBO_MYCTU Group 2 truncated hemoglobin GlbO (Gene Name=glbO)

[Back to BioLiP]