Structure of PDB 2qrd Chain E

Receptor sequence

>2qrdE (length=324) Species: 4896 (Schizosaccharomyces pombe)

MDVQETQKGALKEIQAFIRSRTSYDVLPTSFRLIVFDVTLFVKTSLSLLT
LNNIVSAPLWDSEANKFAGLLTMADFVNVIKYYYQSSSFPEAIAEIDKFR
LLGLREVERKIGAIPPETIYVHPMHSLMDACLAMSKSRARRIPLIDVDGE
TGSEMIVSVLTQYRILKFISMNCKETAMLRVPLNQMTIGTWSNLATASME
TKVYDVIKMLAEKNISAVPIVNSEGTLLNVYESVDVMHLIQDGDYSNLDL
SVGEALLKRPANFDGVHTCRATDRLDGIFDAIKHSRVHRLFVVDENLKLE
GILSLADILNYIIYDKTDNFESAV

3D structure

• PDB: 2qrd Structural Insight into AMPK Regulation: ADP Comes into Play.
• Chain: E
• Resolution: 2.41 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ADP	E	R33 L34 I35 I55 S57 R142 T162 R165 R287 H289	R32 L33 I34 I54 S56 R141 T161 R164 R286 H288
BS02	ATP	E	R139 R141 T191 L195 A196 I216 S217 R290 I303 S305 A307 D308	R138 R140 T190 L194 A195 I215 S216 R289 I302 S304 A306 D307
BS03	ATP	E	R141 Q163 T191 A196 N215 I216 S217 H289 R290 I303 S305 L306 A307 D308	R140 Q162 T190 A195 N214 I215 S216 H288 R289 I302 S304 L305 A306 D307

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0016208 AMP binding
• GO:0019887 protein kinase regulator activity
• GO:0019901 protein kinase binding
• GO:0030295 protein kinase activator activity
• GO:0043531 ADP binding

Biological Process

• GO:0006357 regulation of transcription by RNA polymerase II
• GO:0007165 signal transduction
• GO:0010514 induction of conjugation with cellular fusion

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0031588 nucleotide-activated protein kinase complex

External links

• PDB: RCSB:2qrd, PDBe:2qrd, PDBj:2qrd
• PDBsum: 2qrd
• PubMed: 17937917
• UniProt: Q10343|AAKG_SCHPO 5'-AMP-activated protein kinase subunit gamma (Gene Name=cbs2)