Structure of PDB 2pg1 Chain E

Receptor sequence
>2pg1E (length=104) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
SQFIVDDVSKTIKEAIETTIGGNAYQHDKVNNWTGQVVENCLTVLTKEQK
PYKYIVTAMIMQKNGAGLHTASSCYWNNDTDGSCTVRWENKTMYCIVSVF
GLAV
3D structure
PDB2pg1 Structural and thermodynamic characterization of a cytoplasmic dynein light chain-intermediate chain complex
ChainE
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide E H34 N38 E46 L49 H27 N31 E39 L42
BS02 peptide E N71 G72 G74 L75 H76 T77 A78 S79 S80 C81 Y82 W83 Y101 N64 G65 G67 L68 H69 T70 A71 S72 S73 C74 Y75 W76 Y94
BS03 peptide E T92 R94 T85 R87
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
GO:0045505 dynein intermediate chain binding
GO:0051959 dynein light intermediate chain binding
GO:0097718 disordered domain specific binding
Biological Process
GO:0000278 mitotic cell cycle
GO:0007018 microtubule-based movement
GO:0007286 spermatid development
GO:0008090 retrograde axonal transport
GO:0008340 determination of adult lifespan
Cellular Component
GO:0005737 cytoplasm
GO:0005856 cytoskeleton
GO:0005868 cytoplasmic dynein complex
GO:0005874 microtubule
GO:0030286 dynein complex
GO:0032991 protein-containing complex
GO:1904115 axon cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2pg1, PDBe:2pg1, PDBj:2pg1
PDBsum2pg1
PubMed17551010
UniProtQ94524|DYLT_DROME Dynein light chain Tctex-type (Gene Name=Dlc90F)

[Back to BioLiP]