Structure of PDB 2p7p Chain E |
>2p7pE (length=131) Species: 169963 (Listeria monocytogenes EGD-e) [Search protein sequence] |
MISGLSHITLIVKDLNKTTAFLQNIFNAEEIYSSGDKTFSLSKEKFFLIA GLWICIMEGDSLQERTYNHIAFQIQSEEVDEYTERIKALGVEMKPERPRV QGEGRSIYFYDFDNHLFELHAGTLEERLKRY |
|
PDB | 2p7p Structure and Mechanism of the Genomically Encoded Fosfomycin Resistance Protein, FosX, from Listeria monocytogenes. |
Chain | E |
Resolution | 2.17 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MN |
E |
H69 Y108 E118 |
H69 Y108 E118 |
|
|
|
|