Structure of PDB 2om7 Chain E |
>2om7E (length=124) Species: 274 (Thermus thermophilus) [Search protein sequence] |
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRK VAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGV YDAAGVKDRKKSRSKYGTKKPKEA |
|
PDB | 2om7 Structural basis for interaction of the ribosome with the switch regions of GTP-bound elongation factors. |
Chain | E |
Resolution | 7.3 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
E |
K47 P94 |
K43 P90 |
|
|
|
|