Structure of PDB 2mf1 Chain E

Receptor sequence

>2mf1E (length=59) Species: 220664 (Pseudomonas protegens Pf-5)

MLILTRKVGESINIGDDITITILGVSGQQVRIGINAPKDVAVHREEIYQR
IQAGLTAPD

3D structure

• PDB: 2mf1 Structural basis of the non-coding RNA RsmZ acting as a protein sponge.
• Chain: E
• Resolution: N/A

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	E	L23 S26 Q29 R31 A36 P37 K38 V40 A41 V42 H43 R44	L23 S26 Q29 R31 A36 P37 K38 V40 A41 V42 H43 R44

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0048027 mRNA 5'-UTR binding

Biological Process

• GO:0006109 regulation of carbohydrate metabolic process
• GO:0006402 mRNA catabolic process
• GO:0006417 regulation of translation
• GO:0045947 negative regulation of translational initiation
• GO:0045948 positive regulation of translational initiation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:2mf1, PDBe:2mf1, PDBj:2mf1
• PDBsum: 2mf1
• PubMed: 24828038
• UniProt: P0DPC3|CSRA1_PSEPH Translational regulator CsrA1 (Gene Name=csrA1)