Structure of PDB 2jg9 Chain E |
>2jg9E (length=132) Species: 9606 (Homo sapiens) [Search protein sequence] |
TQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLY YFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQ GENVFLQATDKNSLLGMEGANSIFSGFLLFPD |
|
PDB | 2jg9 C1Q Binds Phosphatidylserine and Likely Acts as a Multiligand-Bridging Molecule in Apoptotic Cell Recognition. |
Chain | E |
Resolution | 1.9 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
E |
D172 Y173 Q179 |
D81 Y82 Q88 |
|
|
|