Structure of PDB 2hnv Chain E

Receptor sequence
>2hnvE (length=81) Species: 9913 (Bos taurus) [Search protein sequence]
VRTCLPCGPGGKGRCFGPSICCGDELGCFVGTAEALRCQEENYLPSPCQS
GVKPCGSGGRCAAAGICCSPDGCHEDPACDP
3D structure
PDB2hnv Contributions of the interdomain loop, amino terminus, and subunit interface to the ligand-facilitated dimerization of neurophysin: crystal structures and mutation studies of bovine neurophysin-I.
ChainE
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 PHE E E47 L50 P51 S52 P53 C54 E41 L44 P45 S46 P47 C48
BS02 TYR E C10 C21 G23 P24 C44 E47 C54 C4 C15 G17 P18 C38 E41 C48
Gene Ontology
Molecular Function
GO:0005185 neurohypophyseal hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:2hnv, PDBe:2hnv, PDBj:2hnv
PDBsum2hnv
PubMed17192588
UniProtP01175|NEU1_BOVIN Oxytocin-neurophysin 1 (Gene Name=OXT)

[Back to BioLiP]