Structure of PDB 2gtl Chain E

Receptor sequence

>2gtlE (length=147) Species: 6398 (Lumbricus terrestris)

DCCSYEDRREIRHIWDDVWSSSFTDRRVAIVRAVFDDLFKHYPTSKALFE
RVKIDEPESGEFKSHLVRVANGLKLLINLLDDTLVLQSHLGHLADQHIQR
KGVTKEYFRGIGEAFARVLPQVLSCFNVDAWNRCFHRLVARIAKDLP

3D structure

• PDB: 2gtl Lumbricus erythrocruorin at 3.5 a resolution: architecture of a megadalton respiratory complex.
• Chain: E
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	E	F53 R55 V56 H101 R104 Y111 F112	F49 R51 V52 H97 R100 Y107 F108
BS02	HEM	E	H96 Q100	H92 Q96

Gene Ontology

Molecular Function

• GO:0005344 oxygen carrier activity
• GO:0005506 iron ion binding
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015671 oxygen transport

Cellular Component

• GO:0005576 extracellular region
• GO:0005833 hemoglobin complex

External links

• PDB: RCSB:2gtl, PDBe:2gtl, PDBj:2gtl
• PDBsum: 2gtl
• PubMed: 16843898
• UniProt: P13579|GLB4_LUMTE Extracellular globin-4