Structure of PDB 2e75 Chain E

Receptor sequence
>2e75E (length=32) Species: 83541 (Mastigocladus laminosus) [Search protein sequence]
MILGAVFYIVFIALFFGIAVGIIFAIKSIKLI
3D structure
PDB2e75 Structure of the Cytochrome b(6)f Complex: Quinone Analogue Inhibitors as Ligands of Heme c(n)
ChainE
Resolution3.55 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide E Y8 F11 F15 Y8 F11 F15
Gene Ontology
Molecular Function
GO:0009055 electron transfer activity
GO:0045158 electron transporter, transferring electrons within cytochrome b6/f complex of photosystem II activity
Biological Process
GO:0015979 photosynthesis
Cellular Component
GO:0009512 cytochrome b6f complex
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2e75, PDBe:2e75, PDBj:2e75
PDBsum2e75
PubMed17498743
UniProtP83795|PETL_MASLA Cytochrome b6-f complex subunit 6 (Gene Name=petL)

[Back to BioLiP]