Structure of PDB 2cnw Chain E

Receptor sequence

>2cnwE (length=279) Species: 271 (Thermus aquaticus)

PWGGNLEEVLEELEMALLAADVGLSATEEILQEVRGRKDLKEAVKEKLVG
MLEPDERRATLRKLGFNPQKPKPVEPKGRVVLVVGVNGVGKTTTIAKLGR
YYQNLGKKVMFCAGDTFRAAGGTQLSEWGKRLSIPVIQGPEGTDPAALAY
DAVQAMKARGYDLLFVDTAGRLHTKHNLMEELKKVKRAIAKADPEEPKEV
WLVLDAVTGQNGLEQAKKFHEAVGLTGVIVTKLDGTAKGGVLIPIVRTLK
VPIKFVGVGEGPDDLQPFDPEAFVEALLE

3D structure

• PDB: 2cnw Structure of a Gdp:Alf(4) Complex of the Srp Gtpases Ffh and Ftsy, and Identification of a Peripheral Nucleotide Interaction Site.
• Chain: E
• Resolution: 2.39 Å

Enzymatic activity

• Enzyme Commision number: 3.6.5.4: signal-recognition-particle GTPase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GDP	E	N111 R142	N87 R118
BS02	GDP	E	G112 G114 K115 T116 T117 K256 D258 G281 G283 E284	G88 G90 K91 T92 T93 K232 D234 G257 G259 E260
BS03	ALF	E	N111 G112 K115 R142 G194	N87 G88 K91 R118 G170
BS04	5GP	E	F141 L202 E205	F117 L178 E181

Gene Ontology

Molecular Function

• GO:0003924 GTPase activity
• GO:0005047 signal recognition particle binding
• GO:0005515 protein binding
• GO:0005525 GTP binding
• GO:0016787 hydrolase activity
• GO:0016887 ATP hydrolysis activity

Biological Process

• GO:0006605 protein targeting
• GO:0006612 protein targeting to membrane
• GO:0006614 SRP-dependent cotranslational protein targeting to membrane

Cellular Component

• GO:0005737 cytoplasm
• GO:0005886 plasma membrane
• GO:0016020 membrane

External links

• PDB: RCSB:2cnw, PDBe:2cnw, PDBj:2cnw
• PDBsum: 2cnw
• PubMed: 16780874
• UniProt: P83749|FTSY_THEAQ Signal recognition particle receptor FtsY (Gene Name=ftsY)