Structure of PDB 2bsq Chain E

Receptor sequence
>2bsqE (length=68) Species: 485 (Neisseria gonorrhoeae) [Search protein sequence]
ASVVIRNLSEATHNAIKFRARAAGRSTEAEIRLILDNIAKAQQTVRLGSM
LASIGQEIGGVELEDVRG
3D structure
PDB2bsq Structure of Fitab from Neisseria Gonorrhoeae Bound to DNA Reveals a Tetramer of Toxin-Antitoxin Heterodimers Containing Pin Domains and Ribbon-Helix-Helix Motifs.
ChainE
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna E S3 V5 R7 S2 V4 R6 PDBbind-CN: Kd=4.5nM
BS02 dna E S27 T28 E29 R33 S26 T27 E28 R32 PDBbind-CN: Kd=4.5nM
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0042803 protein homodimerization activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0044001 migration in host

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2bsq, PDBe:2bsq, PDBj:2bsq
PDBsum2bsq
PubMed16982615
UniProtQ5F881|FITA_NEIG1 Antitoxin FitA (Gene Name=fitA)

[Back to BioLiP]