Structure of PDB 1zla Chain E

Receptor sequence
>1zlaE (length=98) Species: 8355 (Xenopus laevis) [Search protein sequence]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEASEAYLVALFEDTNLCAIHAKRVHIMPKDIQLARRIRGERA
3D structure
PDB1zla The nucleosomal surface as a docking station for Kaposi's sarcoma herpesvirus LANA.
ChainE
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna E H639 R640 Y641 G644 V646 R649 R663 K664 L665 P666 R669 R683 H2 R3 Y4 G7 V9 R12 R26 K27 L28 P29 R32 R46
BS02 dna E Y641 R642 P643 T645 R672 R683 F684 Q685 S686 R716 V717 H718 Y4 R5 P6 T8 R35 R46 F47 Q48 S49 R79 V80 H81
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1zla, PDBe:1zla, PDBj:1zla
PDBsum1zla
PubMed16469929
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]