Structure of PDB 1z5x Chain E

Receptor sequence
>1z5xE (length=237) Species: 7038 (Bemisia tabaci) [Search protein sequence]
PITPEQEELIHRLVYFQNEYEHPSPEDIKRIVNAAPEEENVAEERFRHIT
EITILTVQLIVEFSKRLPGFDKLIREDQIALLKACSSEVMMFRMARRYDA
ETDSILFATNQPYTRESYTVAGMGDTVEDLLRFCRHMCAMKVDNAEYALL
TAIVIFSERPSLSEGWKVEKIQEIYIEALKAYVENRRKPYATTIFAKLLS
VLTELRTLGNMNSETCFSLKLKNRKVPSFLEEIWDVV
3D structure
PDB1z5x The X-ray structure of a hemipteran ecdysone receptor ligand-binding domain: comparison with a lepidopteran ecdysone receptor ligand-binding domain and implications for insecticide design.
ChainE
Resolution3.07 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 P1A E E199 I227 I230 T231 T234 M268 R271 M272 R275 F285 A286 Y296 N390 E21 I49 I52 T53 T56 M90 R93 M94 R97 F107 A108 Y118 N212
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Thu Nov 28 12:31:42 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '1z5x', asym_id = 'E', title = 'The X-ray structure of a hemipteran ecdysone rec... domain and implications for insecticide design. '
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='1z5x', asym_id='E', title='The X-ray structure of a hemipteran ecdysone rec... domain and implications for insecticide design. ')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003677,0004879,0005634,0006355,0035076,0035100', uniprot = '', pdbid = '1z5x', asym_id = 'E'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003677,0004879,0005634,0006355,0035076,0035100', uniprot='', pdbid='1z5x', asym_id='E')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>