Structure of PDB 1ysh Chain E

Receptor sequence
>1yshE (length=84) Species: 4530 (Oryza sativa) [Search protein sequence]
SVTGSKILRILKAHGLAPEIPEDLYFLIKKAVAIRKHLERNRKDKDSKFR
LILVESRIHRLARYYKRTKKLPPTWKYESTTAST
3D structure
PDB1ysh Localization and dynamic behavior of ribosomal protein L30e
ChainE
Resolution9.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna E E119 H123 T144 T145 A146 S147 T148 E55 H59 T80 T81 A82 S83 T84
BS02 rna E E83 I84 F90 I98 H101 N105 K107 D108 D110 S111 F113 R114 R121 E19 I20 F26 I34 H37 N41 K43 D44 D46 S47 F49 R50 R57
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1ysh, PDBe:1ysh, PDBj:1ysh
PDBsum1ysh
PubMed15864315
UniProtQ69UI2|RS131_ORYSJ Small ribosomal subunit protein uS15z (Gene Name=Os08g0117200)

[Back to BioLiP]