Structure of PDB 1y23 Chain E |
>1y23E (length=141) Species: 1423 (Bacillus subtilis) [Search protein sequence] |
ENCIFCKIIAGDIPSAKVYEDEHVLAFLDISQVTKGHTLVIPKTHIENVY EFTDELAKQYFHAVPKIARAIRDEFEPIGLNTLNNNGEKAGQSVFHYHMH IIPRYGKGDGFGAVWKTHADDYKPEDLQNISSSIAKRLASS |
|
PDB | 1y23 Crystal structure of a member of HIT family of proteins from bacillus subtilis |
Chain | E |
Resolution | 2.3 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
E |
C7 C10 H49 H100 |
C3 C6 H45 H96 |
|
|
|
|