Structure of PDB 1xlt Chain E

Receptor sequence

>1xltE (length=359) Species: 1085 (Rhodospirillum rubrum)

MKIAIPKERRPGEDRVAISPEVVKKLVGLGFEVIVEQGAGVGASITDDAL
TAAGATIASTAAQALSQADVVWKVQRPMTAEEGTDEVALIKEGAVLMCHL
GALTNRPVVEALTKRKITAYAMELMPRISRAQSMDILSSQSNLAGYRAVI
DGAYEFARAFPMMMTAAGTVPPARVLVFGVGVAGLQAIATAKRLGAVVMA
TDVRAATKEQVESLGGKFITVEEFRKKQAEAVLKELVKTDIAITTALIPG
KPAPVLITEEMVTKMKPGSVIIDLAVEAGGNCPLSEPGKIVVKHGVKIVG
HTNVPSRVAADASPLFAKNLLNFLTPHVDKDTKTLVMKLEDETVSGTCVT
RDGAIVHPA

3D structure

• PDB: 1xlt Conformational Diversity in NAD(H) and Transhydrogenase Nicotinamide Nucleotide Binding Domains
• Chain: E
• Resolution: 3.1 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): R15 Q75 H99 G101 E123 R127 Q132 D135 S138 E296
• Catalytic site (residue number reindexed from 1): R15 Q75 H99 G101 E123 R127 Q132 D135 S138 E277
• Enzyme Commision number: 7.1.1.1: proton-translocating NAD(P)(+) transhydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FRU	E	E155 K316	E155 K297
BS02	FRU	E	R147 R326	R147 R307

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0003957 NAD(P)+ transhydrogenase (Si-specific) activity
• GO:0005515 protein binding
• GO:0008750 proton-translocating NAD(P)+ transhydrogenase activity
• GO:0016491 oxidoreductase activity
• GO:0046983 protein dimerization activity
• GO:0050661 NADP binding
• GO:0051287 NAD binding
• GO:0070403 NAD+ binding
• GO:0070404 NADH binding

Biological Process

• GO:0006740 NADPH regeneration
• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0005886 plasma membrane

External links

• PDB: RCSB:1xlt, PDBe:1xlt, PDBj:1xlt
• PDBsum: 1xlt
• PubMed: 15670609
• UniProt: Q2RSB2|PNTAA_RHORT NAD(P) transhydrogenase subunit alpha part 1 (Gene Name=pntAA)