Structure of PDB 1wrl Chain E

Receptor sequence
>1wrlE (length=83) Species: 9606 (Homo sapiens) [Search protein sequence]
DIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQNP
TPEELQEMIDEVDEDGSGTVDFDEFLVMMVRSM
3D structure
PDB1wrl Crystal structure of the N-terminal domain of human cardiac troponin C in complex with trifluoperazine
ChainE
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA E D65 D67 S69 T71 E76 D63 D65 S67 T69 E74
BS02 TFP E M45 Q50 E56 M60 M80 M43 Q48 E54 M58 M78
BS03 TFP E F27 L48 M81 S84 M85 F25 L46 M79 S82 M83
BS04 TFP E E19 F20 E17 F18
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding

View graph for
Molecular Function
External links
PDB RCSB:1wrl, PDBe:1wrl, PDBj:1wrl
PDBsum1wrl
PubMed
UniProtP63316|TNNC1_HUMAN Troponin C, slow skeletal and cardiac muscles (Gene Name=TNNC1)

[Back to BioLiP]