Structure of PDB 1u1g Chain E

Receptor sequence
>1u1gE (length=247) Species: 562 (Escherichia coli) [Search protein sequence]
KSDVFHLGLTKNDLQGATLAIVPGDPDRVEKIAALMDKPVKLASHREFTT
WRAELDGKPVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHI
NVGDVLVTTASVRLDGASLHFAPLEFPAVADFECTTALVEAAKSIGATTH
VGVTASSDTFYPGQERYDTYSGRVVRHFKGSMEEWQAMGVMNYEMESATL
LTMCASQGLRAGMVAGVIVNRTQNAETMKQTESHAVKIVVEAARRLL
3D structure
PDB1u1g Structural basis for inhibition of Escherichia coli uridine phosphorylase by 5-substituted acyclouridines.
ChainE
Resolution1.95 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H8 G26 R30 R48 E80 R91 T94 R168 I220 V221 R223 M234
Catalytic site (residue number reindexed from 1) H6 G24 R28 R46 E78 R89 T92 R166 I218 V219 R221 M228
Enzyme Commision number 2.4.2.3: uridine phosphorylase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 BBB E T94 T95 F162 Q166 R168 M197 I220 M234 T92 T93 F160 Q164 R166 M195 I218 M228
BS02 BBB E F7 H8 R48 F5 H6 R46
Gene Ontology
Molecular Function
GO:0003824 catalytic activity
GO:0004850 uridine phosphorylase activity
GO:0005524 ATP binding
GO:0016757 glycosyltransferase activity
GO:0016763 pentosyltransferase activity
GO:0030955 potassium ion binding
GO:0042802 identical protein binding
GO:0047847 deoxyuridine phosphorylase activity
Biological Process
GO:0006218 uridine catabolic process
GO:0006974 DNA damage response
GO:0009116 nucleoside metabolic process
GO:0009164 nucleoside catabolic process
GO:0009166 nucleotide catabolic process
GO:0044206 UMP salvage
GO:0046050 UMP catabolic process
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0032991 protein-containing complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1u1g, PDBe:1u1g, PDBj:1u1g
PDBsum1u1g
PubMed15983408
UniProtP12758|UDP_ECOLI Uridine phosphorylase (Gene Name=udp)

[Back to BioLiP]