Structure of PDB 1trr Chain E

Receptor sequence
>1trrE (length=104) Species: 562 (Escherichia coli) [Search protein sequence]
AQQSPYSAAMAEQRHEEWLRFVDLLKNAYQNDLHLPLLNLMLTPDEREAL
GTRVRIVEELLRGEMSQRELKNELGAGIATITRGSNSLKAAPVELRQWLE
EVLL
3D structure
PDB1trr Tandem binding in crystals of a trp repressor/operator half-site complex.
ChainE
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna E S67 Q68 R69 I79 T83 S86 K90 S66 Q67 R68 I78 T82 S85 K89
BS02 dna E T44 D46 T43 D45
BS03 dna E G78 I79 G77 I78
BS04 dna E A2 R54 G76 A77 G78 T81 R84 A1 R53 G75 A76 G77 T80 R83
BS05 TRP E R54 R84 G85 S88 R53 R83 G84 S87
BS06 TRP E L41 L43 T44 L40 L42 T43
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1trr, PDBe:1trr, PDBj:1trr
PDBsum1trr
PubMed8232559
UniProtP0A881|TRPR_ECOLI Trp operon repressor (Gene Name=trpR)

[Back to BioLiP]