Structure of PDB 1tro Chain E

Receptor sequence
>1troE (length=97) Species: 316407 (Escherichia coli str. K-12 substr. W3110) [Search protein sequence]
AEERHQEWLRFVDLLKNAYQNDLHLPLLNLMLTPDEREALGTRVRIVEEL
LRGEMSQRELKNELGAGIATITRGSNSLKAAPVELRQWLEEVLLKSD
3D structure
PDB1tro Crystal structure of trp repressor/operator complex at atomic resolution.
ChainE
Resolution1.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna E T44 D46 Q68 R69 S86 K90 T33 D35 Q57 R58 S75 K79
BS02 dna E R54 A77 T81 R84 R43 A66 T70 R73
BS03 TRP E R54 R84 G85 R43 R73 G74
BS04 TRP E L41 L43 T44 L30 L32 T33
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1tro, PDBe:1tro, PDBj:1tro
PDBsum1tro
PubMed3419502
UniProtP0A881|TRPR_ECOLI Trp operon repressor (Gene Name=trpR)

[Back to BioLiP]