Structure of PDB 1s5l Chain E

Receptor sequence
>1s5lE (length=76) Species: 146786 (Thermosynechococcus vestitus) [Search protein sequence]
PFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQ
EQRSIPLVTDRFEAKQQVETFLEQLK
3D structure
PDB1s5l Architecture of the Photosynthetic Oxygen-Evolving Center
ChainE
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEC E I12 Y18 H22 T25 I5 Y11 H15 T18
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0009767 photosynthetic electron transport chain
GO:0015979 photosynthesis
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005737 cytoplasm
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1s5l, PDBe:1s5l, PDBj:1s5l
PDBsum1s5l
PubMed14764885
UniProtQ8DIP0|PSBE_THEVB Cytochrome b559 subunit alpha (Gene Name=psbE)

[Back to BioLiP]