Structure of PDB 1rd9 Chain E

Receptor sequence

>1rd9E (length=103) Species: 666 (Vibrio cholerae)

TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQV
EVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAIS
MAN

3D structure

• PDB: 1rd9 Nonspanning bivalent ligands as improved surface receptor binding inhibitors of the cholera toxin B pentamer.
• Chain: E
• Resolution: 1.44 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BV2	E	Y12 E51 H57 Q61 W88 N90 K91	Y12 E51 H57 Q61 W88 N90 K91	MOAD: ic50=13uM

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0005534 galactose binding
• GO:0046812 host cell surface binding
• GO:0090729 toxin activity

Biological Process

• GO:0035821 modulation of process of another organism
• GO:0042531 positive regulation of tyrosine phosphorylation of STAT protein

Cellular Component

• GO:0005576 extracellular region
• GO:0016020 membrane
• GO:0020002 host cell plasma membrane
• GO:0042597 periplasmic space
• GO:1902494 catalytic complex

External links

• PDB: RCSB:1rd9, PDBe:1rd9, PDBj:1rd9
• PDBsum: 1rd9
• PubMed: 15380181
• UniProt: P01556|CHTB_VIBCH Cholera enterotoxin subunit B (Gene Name=ctxB)