Structure of PDB 1p3l Chain E

Receptor sequence
>1p3lE (length=99) Species: 8355 (Xenopus laevis) [Search protein sequence]
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS
SAVMALQEASEAYLVALFEDTNLCAIHAKRVHIMPKDIQLARRIRGERA
3D structure
PDB1p3l Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
ChainE
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna E H639 R640 Y641 V646 R649 K656 R663 K664 L665 R669 R683 K715 H718 H3 R4 Y5 V10 R13 K20 R27 K28 L29 R33 R47 K79 H82
BS02 dna E R640 Y641 R642 T645 R672 R683 F684 R716 V717 H718 R4 Y5 R6 T9 R36 R47 F48 R80 V81 H82
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1p3l, PDBe:1p3l, PDBj:1p3l
PDBsum1p3l
PubMed14739929
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]