Structure of PDB 1m1a Chain E

Receptor sequence
>1m1aE (length=98) Species: 8355 (Xenopus laevis) [Search protein sequence]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
3D structure
PDB1m1a Crystal Structures of Nucleosome Core Particles in Complex with Minor Groove DNA-binding Ligands
ChainE
Resolution2.65 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna E R640 Y641 P643 G644 T645 V646 A647 R649 K656 R663 K664 L665 R669 R3 Y4 P6 G7 T8 V9 A10 R12 K19 R26 K27 L28 R32 PDBbind-CN: Kd=0.6uM
BS02 dna E H639 R640 R642 P643 R672 R683 F684 Q685 R716 V717 T718 H2 R3 R5 P6 R35 R46 F47 Q48 R79 V80 T81 PDBbind-CN: Kd=0.6uM
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1m1a, PDBe:1m1a, PDBj:1m1a
PDBsum1m1a
PubMed12559907
UniProtP02302|H3C_XENLA Histone H3.3C (Gene Name=h3-5)

[Back to BioLiP]