Structure of PDB 1m18 Chain E

Receptor sequence
>1m18E (length=99) Species: 8355 (Xenopus laevis) [Search protein sequence]
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS
SAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
3D structure
PDB1m18 Crystal Structures of Nucleosome Core Particles in Complex with Minor Groove DNA-binding Ligands
ChainE
Resolution2.45 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna E H639 R640 Y641 P643 G644 V646 A647 R649 R663 K664 L665 P666 R669 R683 H3 R4 Y5 P7 G8 V10 A11 R13 R27 K28 L29 P30 R33 R47 PDBbind-CN: Kd=0.6uM
BS02 dna E R640 Y641 R642 P643 T645 R663 R672 R683 F684 Q685 R716 V717 T718 R4 Y5 R6 P7 T9 R27 R36 R47 F48 Q49 R80 V81 T82 PDBbind-CN: Kd=0.6uM
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1m18, PDBe:1m18, PDBj:1m18
PDBsum1m18
PubMed12559907
UniProtP02302|H3C_XENLA Histone H3.3C (Gene Name=h3-5)

[Back to BioLiP]