Structure of PDB 1lv8 Chain E
Receptor sequence
| >1lv8E (length=265) Species: 9913 (Bos taurus) [Search protein sequence] |
| NGYTYEDYQDTAKWLLSHTEQRPQVAVICGSGLGGLVNKLTQAQTFDYSE IPNFPESTVPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRV FRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGQNPLRGPNE ERFGVRFPAMSDAYDRDMRQKAHSTWKQMGEQRELQEGTYVMLGGPNFET VAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDQAAQ KLEQFVSLLMASIPV |
3D structure
| PDB | 1lv8 Crystal structure of calf spleen purine nucleoside phosphorylase with two full trimers in the asymmetric unit: important implications for the mechanism of catalysis | ||
| Chain | E | ||
| Resolution | 2.3 Å | ||
| 3D structure |
|
Enzymatic activity
| Catalytic site (original residue number in PDB) | S1033 H1064 Y1088 A1116 M1219 S1220 |
| Catalytic site (residue number reindexed from 1) | S31 H62 Y86 A114 M217 S218 |
| Enzyme Commision number | 2.4.2.1: purine-nucleoside phosphorylase. |
Interaction with ligand
| Site # |
Ligand | Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
|---|---|---|---|---|---|
| BS01 | CA | E | S1051 E1058 | S49 E56 | |
| BS02 | 9PP | E | S1033 N1115 A1116 F1200 E1201 S1220 N1243 | S31 N113 A114 F198 E199 S218 N241 | MOAD: Kd=3.5uM |
Gene Ontology
| Molecular Function | |
|---|---|
| GO:0003824 | catalytic activity |
| GO:0004731 | purine-nucleoside phosphorylase activity |
| GO:0016757 | glycosyltransferase activity |
| GO:0016763 | pentosyltransferase activity |
| GO:0047975 | guanosine phosphorylase activity |
