Structure of PDB 1kx5 Chain E

Receptor sequence
>1kx5E (length=135) Species: 8355 (Xenopus laevis) [Search protein sequence]
ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALRE
IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYL
VALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
3D structure
PDB1kx5 Solvent Mediated Interactions in the Structure of the Nucleosome Core Particle at 1.9 A Resolution
ChainE
Resolution1.94 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna E H39 R40 Y41 G44 V46 A47 R49 R63 K64 L65 P66 R69 R83 H39 R40 Y41 G44 V46 A47 R49 R63 K64 L65 P66 R69 R83
BS02 dna E A25 K37 Y41 R42 T45 R63 R72 R83 F84 Q85 R116 V117 T118 A25 K37 Y41 R42 T45 R63 R72 R83 F84 Q85 R116 V117 T118
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1kx5, PDBe:1kx5, PDBj:1kx5
PDBsum1kx5
PubMed12079350
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]