Structure of PDB 1kj2 Chain E |
>1kj2E (length=117) Species: 10090 (Mus musculus) [Search protein sequence] |
VTLLEQNPRWRLVPRGQAVNLRCILKNSQYPWMSWYQQDLQKQLQWLFTL RSPGDKEVKSLPGADYLATRVTDTELRLQVANMSQGRTLYCTCSAAPDWG ASAETLYFGSGTRLTVL |
|
PDB | 1kj2 A T cell receptor CDR3beta loop undergoes conformational changes of unprecedented magnitude upon binding to a peptide/MHC class I complex. |
Chain | E |
Resolution | 2.71 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
E |
R50 D99 |
R51 D98 |
|
|
|