Structure of PDB 1jm0 Chain E

Receptor sequence
>1jm0E (length=48) [Search protein sequence]
DYLRELLKLELQAIKQYREALEYVKLPVLAKILEDEEKHIEWLETILG
3D structure
PDB1jm0 Toward the de novo design of a catalytically active helix bundle: a substrate-accessible carboxylate-bridged dinuclear metal center.
ChainE
Resolution1.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MN E E10 E36 H39 E10 E36 H39
BS02 MN E E34 E37 E34 E37
BS03 DMS E E10 E36 E10 E36
External links