Structure of PDB 1id3 Chain E

Receptor sequence

>1id3E (length=97) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

PHRYKPGTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AIGALQESVEAYLVSLFEDTNLAAIHAKRVTIQKKEIKLARRLRGER

3D structure

PDB

1id3 Structure of the yeast nucleosome core particle reveals fundamental changes in internucleosome interactions.

Chain

Resolution

3.1 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	E	H39 R40 Y41 G44 V46 A47 R49 R63 L65 R69 R83	H2 R3 Y4 G7 V9 A10 R12 R26 L28 R32 R46
BS02	dna	E	R40 Y41 K42 P43 T45 R72 R83 F84 Q85 S86 R116 V117 T118	R3 Y4 K5 P6 T8 R35 R46 F47 Q48 S49 R79 V80 T81
BS03	MN	E	R49 R53	R12 R16

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0005515	protein binding
GO:0008823	cupric reductase (NADH) activity
GO:0030527	structural constituent of chromatin
GO:0046982	protein heterodimerization activity

	Biological Process
GO:0006325	chromatin organization
GO:0006355	regulation of DNA-templated transcription
GO:0006878	intracellular copper ion homeostasis
GO:0009060	aerobic respiration
GO:0009303	rRNA transcription
GO:0042790	nucleolar large rRNA transcription by RNA polymerase I
GO:0043935	sexual sporulation resulting in formation of a cellular spore
GO:0045943	positive regulation of transcription by RNA polymerase I
GO:0070911	global genome nucleotide-excision repair

	Cellular Component
GO:0000500	RNA polymerase I upstream activating factor complex
GO:0000786	nucleosome
GO:0005634	nucleus
GO:0005694	chromosome
GO:0031298	replication fork protection complex
GO:0032991	protein-containing complex
GO:0043505	CENP-A containing nucleosome

External links

PDB	RCSB:1id3, PDBe:1id3, PDBj:1id3
PDBsum	1id3
PubMed	11566884
UniProt	P61830\|H3_YEAST Histone H3 (Gene Name=HHT1)