Structure of PDB 1hv4 Chain E

Receptor sequence

>1hv4E (length=141) Species: 8846 (Anser indicus)

VLSAADKTNVKGVFSKISGHAEEYGAETLERMFTAYPQTKTYFPHFDLQH
GSAQIKAHGKKVVAALVEAVNHIDDIAGALSKLSDLHAQKLRVDPVNFKF
LGHCFLVVVAIHHPSALTAEVHASLDKFLCAVGTVLTAKYR

3D structure

• PDB: 1hv4 The crystal structure of bar-headed goose hemoglobin in deoxy form: the allosteric mechanism of a hemoglobin species with high oxygen affinity.
• Chain: E
• Resolution: 2.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	E	Y42 F43 H45 F46 H58 K61 L83 H87 L91 N97 F98 L101	Y42 F43 H45 F46 H58 K61 L83 H87 L91 N97 F98 L101

Gene Ontology

Molecular Function

• GO:0004601 peroxidase activity
• GO:0005344 oxygen carrier activity
• GO:0005506 iron ion binding
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0031720 haptoglobin binding
• GO:0043177 organic acid binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015671 oxygen transport
• GO:0042744 hydrogen peroxide catabolic process
• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0005833 hemoglobin complex
• GO:0031838 haptoglobin-hemoglobin complex
• GO:0072562 blood microparticle

External links

• PDB: RCSB:1hv4, PDBe:1hv4, PDBj:1hv4
• PDBsum: 1hv4
• PubMed: 11601851
• UniProt: P01990|HBA_ANSIN Hemoglobin subunit alpha-A (Gene Name=HBAA)