Structure of PDB 1hq3 Chain E |
>1hq3E (length=104) Species: 9031 (Gallus gallus) [Search protein sequence] |
AKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEIL ELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQA VLLP |
|
PDB | 1hq3 Structure of the histone-core octamer in KCl/phosphate crystals at 2.15 A resolution. |
Chain | E |
Resolution | 2.15 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
PO4 |
E |
R29 R32 K36 |
R16 R19 K23 |
|
|
|
|