Structure of PDB 1f6m Chain E

Receptor sequence

>1f6mE (length=320) Species: 562 (Escherichia coli)

GTTKHSKLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTTEVE
NWPGDPNDLTGPLLMERMHEHATKFETEIIFDHINKVDLQNRPFRLNGDN
GEYTCDALIIATGASARYLGLPSEEAFKGRGVSASATCDGFFYRNQKVAV
IGGGNTAVEEALYLSNIASEVHLIHRRDGFRAEKILIKRLMDKVENGNII
LHTNRTLEEVTGDQMGVTGVRLRDTQNSDNIESLDVAGLFVAIGHSPNTA
IFEGQLELENGYIKVQSGIHGNATQTSIPGVFAAGDVMDHIYRQAITSAG
TGCMAALDAERYLDGLADAK

3D structure

• PDB: 1f6m Twists in catalysis: alternating conformations of Escherichia coli thioredoxin reductase.
• Chain: E
• Resolution: 2.95 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): S135 C138 D139
• Catalytic site (residue number reindexed from 1): S135 C138 D139
• Enzyme Commision number: 1.8.1.9: thioredoxin-disulfide reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	E	G12 S13 G14 P15 A16 T35 G36 E38 G41 Q42 L43 T46 N51 H83 I84 A111 T112 G113 H245 G285 D286 R293 Q294 A295 S298	G12 S13 G14 P15 A16 T35 G36 E38 G41 Q42 L43 T46 N51 H83 I84 A111 T112 G113 H245 G285 D286 R293 Q294 A295 S298
BS02	3AA	E	L119 G153 G154 N155 T156 E159 H175 R176 R177 R181 I243 G244 H245 R293 Q294	L119 G153 G154 N155 T156 E159 H175 R176 R177 R181 I243 G244 H245 R293 Q294

Gene Ontology

Molecular Function

• GO:0004791 thioredoxin-disulfide reductase (NADPH) activity
• GO:0005515 protein binding
• GO:0016491 oxidoreductase activity
• GO:0050660 flavin adenine dinucleotide binding

Biological Process

• GO:0019430 removal of superoxide radicals
• GO:0045454 cell redox homeostasis

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:1902515 thioredoxin-disulfide reductase complex

External links

• PDB: RCSB:1f6m, PDBe:1f6m, PDBj:1f6m
• PDBsum: 1f6m
• PubMed: 10947986
• UniProt: P0A9P4|TRXB_ECOLI Thioredoxin reductase (Gene Name=trxB)