Structure of PDB 1f66 Chain E

Receptor sequence
>1f66E (length=103) Species: 8355 (Xenopus laevis) [Search protein sequence]
GEVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL
RFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRG
ERA
3D structure
PDB1f66 Crystal structure of a nucleosome core particle containing the variant histone H2A.Z.
ChainE
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna E R640 Y641 G644 V646 A647 R649 R663 K664 L665 P666 R669 R683 R8 Y9 G12 V14 A15 R17 R31 K32 L33 P34 R37 R51
BS02 dna E K636 K637 Y641 R642 T645 R663 R672 R683 F684 Q685 R716 V717 T718 K4 K5 Y9 R10 T13 R31 R40 R51 F52 Q53 R84 V85 T86
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1f66, PDBe:1f66, PDBj:1f66
PDBsum1f66
PubMed11101893
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]