Structure of PDB 1f51 Chain E |
>1f51E (length=119) Species: 1423 (Bacillus subtilis) [Search protein sequence] |
NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVL LDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHF AKPFDIDEIRDAVKKYLPL |
|
PDB | 1f51 A transient interaction between two phosphorelay proteins trapped in a crystal lattice reveals the mechanism of molecular recognition and phosphotransfer in signal transduction. |
Chain | E |
Resolution | 3.0 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
E |
D1211 D1254 |
D9 D52 |
|
|
|
|