Structure of PDB 1cmk Chain E

Receptor sequence

>1cmkE (length=350) Species: 9823 (Sus scrofa) [Search protein sequence]

GNAAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLG
TGSFGRVMLVKHKETGNHFAMKILDKQKVVKLKQIEHTLNEKRILQAVNF
PFLVKLEYSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQI
VLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCG
TPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKI
VSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKDGVNDIKNHKWFATT
DWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF

3D structure

PDB

1cmk Crystal structures of the myristylated catalytic subunit of cAMP-dependent protein kinase reveal open and closed conformations.

Chain

Resolution

2.9 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	N171 D184
Catalytic site (residue number reindexed from 1)	N171 D184
Enzyme Commision number	2.7.11.11: cAMP-dependent protein kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	E	H87 F129 R133 K168 E170 F187 T197 L198 C199 G200 T201 P202 E203 E230 Y235 F239 A240	H87 F129 R133 K168 E170 F187 T197 L198 C199 G200 T201 P202 E203 E230 Y235 F239 A240
BS02	MYR	E	G1 S14 F18 F100 L152 E155 Y156 I303 Y306	G1 S14 F18 F100 L152 E155 Y156 I303 Y306

Gene Ontology

	Molecular Function
GO:0004672	protein kinase activity
GO:0004674	protein serine/threonine kinase activity
GO:0004679	AMP-activated protein kinase activity
GO:0004691	cAMP-dependent protein kinase activity
GO:0005524	ATP binding
GO:0034237	protein kinase A regulatory subunit binding
GO:0106310	protein serine kinase activity

	Biological Process
GO:0006468	protein phosphorylation
GO:0010737	protein kinase A signaling
GO:0016310	phosphorylation
GO:0034605	cellular response to heat
GO:1904145	negative regulation of meiotic cell cycle process involved in oocyte maturation
GO:1904262	negative regulation of TORC1 signaling

	Cellular Component
GO:0001669	acrosomal vesicle
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005829	cytosol
GO:0005886	plasma membrane
GO:0005952	cAMP-dependent protein kinase complex
GO:0036126	sperm flagellum
GO:0042585	germinal vesicle
GO:0048471	perinuclear region of cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1cmk, PDBe:1cmk, PDBj:1cmk
PDBsum	1cmk
PubMed	8251932
UniProt	P36887\|KAPCA_PIG cAMP-dependent protein kinase catalytic subunit alpha (Gene Name=PRKACA)

[Back to BioLiP]