Structure of PDB 1a9w Chain E

Receptor sequence
>1a9wE (length=145) Species: 9606 (Homo sapiens) [Search protein sequence]
VHFTAEEKAAVTSLWSKMNVEEAGGEALGRLLVVYPWTQRFFDSFGNLSS
PSAILGNPKVKAHGKKVLTSFGDAIKNMDNLKPAFAKLSELHCDKLHVDP
ENFKLLGNVMVIILATHFGKEFTPEVQAAWQKLVSAVAIALAHKY
3D structure
PDB1a9w Crystal structure of a human embryonic haemoglobin: the carbonmonoxy form of gower II (alpha2 epsilon2) haemoglobin at 2.9 A resolution.
ChainE
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM E T38 F41 F42 H63 H92 L96 N102 F103 L106 T38 F41 F42 H63 H92 L96 N102 F103 L106
Gene Ontology
Molecular Function
GO:0004601 peroxidase activity
GO:0005344 oxygen carrier activity
GO:0005515 protein binding
GO:0019825 oxygen binding
GO:0020037 heme binding
GO:0031720 haptoglobin binding
GO:0031721 hemoglobin alpha binding
GO:0043177 organic acid binding
GO:0044877 protein-containing complex binding
GO:0046872 metal ion binding
Biological Process
GO:0014070 response to organic cyclic compound
GO:0015670 carbon dioxide transport
GO:0015671 oxygen transport
GO:0042744 hydrogen peroxide catabolic process
GO:0098869 cellular oxidant detoxification
Cellular Component
GO:0005829 cytosol
GO:0005833 hemoglobin complex
GO:0031838 haptoglobin-hemoglobin complex
GO:0072562 blood microparticle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1a9w, PDBe:1a9w, PDBj:1a9w
PDBsum1a9w
PubMed9665850
UniProtP02100|HBE_HUMAN Hemoglobin subunit epsilon (Gene Name=HBE1)

[Back to BioLiP]