Structure of PDB 8rdw Chain Dm

Receptor sequence

>8rdwDm (length=212) Species: 45610 (Psychrobacter urativorans) [Search protein sequence]

ARYIGPKLKLSRREGTDLGLKSGVKPYDVKTKKAARPPGQHGVSRNKTSE
YALQLREKQKVKRIYGVLERQFANYYKEAARKRGATGENLLAMLESRLDN
VVYRMGFGSTRAEARQLVSHRTVMVKKAGRDEFVRVNIPSIQLQDGDVIA
IQEKSREQLRIKNAIELATQRGIPEWLDVDHSKLQGTFKKAPDRIDLPAE
INESLIVELYSK

3D structure

PDB

8rdw A new family of bacterial ribosome hibernation factors

Chain

Resolution

2.74 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Dm	A2 R3 P7 K8 L9 K10 R13 R14 K22 S23 K26 K31 T32 K33 K34 R37 P39 G40 Q41 H42 Y52 L56 R57 K59 Q60 K63 L69 E70 R71 Q72 N75 R82 T111 A113 E114 R116 Q117 S120 H121 R122 R131 R136 V137 N138 I139 S141 I142 Q159 E209 S212 K213	A1 R2 P6 K7 L8 K9 R12 R13 K21 S22 K25 K30 T31 K32 K33 R36 P38 G39 Q40 H41 Y51 L55 R56 K58 Q59 K62 L68 E69 R70 Q71 N74 R81 T110 A112 E113 R115 Q116 S119 H120 R121 R130 R135 V136 N137 I138 S140 I141 Q158 E208 S211 K212

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation
GO:0042274	ribosomal small subunit biogenesis

	Cellular Component
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8rdw, PDBe:8rdw, PDBj:8rdw
PDBsum	8rdw
PubMed	38355796
UniProt	A0A0M4TE52

[Back to BioLiP]