Structure of PDB 4v88 Chain Dl

Receptor sequence

>4v88Dl (length=50) Species: 559292 (Saccharomyces cerevisiae S288C)

AAQKSFRIKQKMAKAKKQNRPLPQWIRLRTNNTIRYNAKRRNWRRTKMNI

3D structure

• PDB: 4v88 The structure of the eukaryotic ribosome at 3.0 angstrom resolution.
• Chain: Dl
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Dl	A2 A3 Q4 K5 F7 K10 M13 P22 Y37 A39 K40 R41 R42 W44 R45 K48 M49	A1 A2 Q3 K4 F6 K9 M12 P21 Y36 A38 K39 R40 R41 W43 R44 K47 M48
BS02	rna	Dl	F7 R8 K12 K15 K18 Q19 R21 L23 W26 I27 L29 R30 T31 I35 K40	F6 R7 K11 K14 K17 Q18 R20 L22 W25 I26 L28 R29 T30 I34 K39
BS03	MG	Dl	A3 Q4	A2 Q3

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v88, PDBe:4v88, PDBj:4v88
• PDBsum: 4v88
• PubMed: 22096102
• UniProt: P04650|RL39_YEAST Large ribosomal subunit protein eL39 (Gene Name=RPL39)