Structure of PDB 6zqc Chain Db

Receptor sequence
>6zqcDb (length=81) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
VLVQDLLHPTAASEARKHKLKTLVQGPRSYFLDVKCPGCLNITTVFSHAQ
TAVTCESCSTILCTPTGGKAKLSEGTSFRRK
3D structure
PDB6zqc 90 S pre-ribosome transformation into the primordial 40 S subunit.
ChainDb
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Db R17 K20 L21 Q26 P28 S30 Q51 G68 G69 K70 K72 R16 K19 L20 Q25 P27 S29 Q50 G67 G68 K69 K71
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0044391 ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6zqc, PDBe:6zqc, PDBj:6zqc
PDBsum6zqc
PubMed32943521
UniProtP35997|RS27A_YEAST Small ribosomal subunit protein eS27A (Gene Name=RPS27A)

[Back to BioLiP]