Structure of PDB 7pua Chain Da

Receptor sequence
>7puaDa (length=36) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence]
IAHWYCGHKFRHRFMRDKRFHPSLQASHDARNRFSK
3D structure
PDB7pua Mitoribosomal small subunit maturation involves formation of initiation-like complexes.
ChainDa
Resolution3.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Da I10 A11 H12 W13 Y14 R22 R25 R28 F29 Q34 R40 N41 S44 I1 A2 H3 W4 Y5 R13 R16 R19 F20 Q25 R31 N32 S35
BS02 rna Da K18 F19 R20 H21 F23 M24 F43 K9 F10 R11 H12 F14 M15 F34
External links