Structure of PDB 4wt8 Chain Da

Receptor sequence

>4wt8Da (length=84) Species: 300852 (Thermus thermophilus HB8)

AHKKGLGSTRNGRDSQAKRLGVKRYEGQVVRAGNILVRQRGTRFKPGKNV
GMGRDFTLFALVDGVVEFQDRGRLGRYVHVRPLA

3D structure

• PDB: 4wt8 Bactobolin A Binds to a Site on the 70S Ribosome Distinct from Previously Seen Antibiotics.
• Chain: Da
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Da	A2 L7 R11	A1 L6 R10
BS02	rna	Da	H3 S9 T10 N12 R14 D15 S16 Q17 K19 R20 K24 R25 Y26 E27 G28 Q29 R32 A33 G34 N35 I36 R39 R41 T43 R44 F45 R55 D56 F57 F60 F69 R77	H2 S8 T9 N11 R13 D14 S15 Q16 K18 R19 K23 R24 Y25 E26 G27 Q28 R31 A32 G33 N34 I35 R38 R40 T42 R43 F44 R54 D55 F56 F59 F68 R76

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4wt8, PDBe:4wt8, PDBj:4wt8
• PDBsum: 4wt8
• PubMed: 25562208
• UniProt: P60493|RL27_THET8 Large ribosomal subunit protein bL27 (Gene Name=rpmA)