Structure of PDB 4v9n Chain DZ

Receptor sequence
>4v9nDZ (length=187) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
YRLKAYYREGEKPSALRRAGKLPGVMYNRHLNRKVYVDLVEFDKVFRQAS
IHHVIVLELPDGQSLPTLVRQVNLDKRRRRPEHVDFFVLSDEPVEMYVPL
RFVGTPAGVRAGGVLQEIHRDILVKVSPRNIPEFIEVDVSGLEIGDSLHA
SDLKLPPGVELAVSPEETIAAVVPPEDVEKLAEEAAA
3D structure
PDB4v9n Crystal Structure of the 70S Ribosome Bound with the Q253P Mutant Form of Release Factor RF2.
ChainDZ
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna DZ Q118 I146 S149 H151 E169 T170 Q116 I144 S147 H149 E167 T168
BS02 rna DZ R10 P15 R19 R20 V27 Y29 N30 R31 N34 R72 Q73 N75 E84 H85 F89 R8 P13 R17 R18 V25 Y27 N28 R29 N32 R70 Q71 N73 E82 H83 F87
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v9n, PDBe:4v9n, PDBj:4v9n
PDBsum4v9n
PubMed23769667
UniProtQ72IA7|RL25_THET2 Large ribosomal subunit protein bL25 (Gene Name=rplY)

[Back to BioLiP]