Structure of PDB 4v8b Chain DZ

Receptor sequence

>4v8bDZ (length=97) Species: 300852 (Thermus thermophilus HB8)

SKVCEISGKRPIVANSIQRRGKAKREGGVGKKTTGISKRRQYPNLQKVRV
RVAGQEITFRVAASHIPKVYELVERAKGLKLEGLSPKEIKKELLKLL

3D structure

• PDB: 4v8b A new understanding of the decoding principle on the ribosome.
• Chain: DZ
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	DZ	S2 K3 K10 R11 I13 V14 A15 N16 Q19 R20 R21 A24 K25 G28 G29 V30 G31 K33 T34 T35 K39 R40 R41 Q42 Y43 P44 N45 Q47 R50 R52 H66 K69 K88 L94	S1 K2 K9 R10 I12 V13 A14 N15 Q18 R19 R20 A23 K24 G27 G28 V29 G30 K32 T33 T34 K38 R39 R40 Q41 Y42 P43 N44 Q46 R49 R51 H65 K68 K87 L93

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v8b, PDBe:4v8b, PDBj:4v8b
• PDBsum: 4v8b
• PubMed: 22437501
• UniProt: P60494|RL28_THET8 Large ribosomal subunit protein bL28 (Gene Name=rpmB)