Structure of PDB 4v6a Chain DZ

Receptor sequence
>4v6aDZ (length=176) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
YRLKAYYREGEKPSALRRAGKLPGVMYNRHLNRKVYVDLVEFDKVFRQAS
IHHVIVLELPDGQSLPTLVRQVNLDKRRRRPEHVDFFVLSDEPVEMYVPL
RFVGTPAGVRAGGVLQEIHRDILVKVSPRNIPEFIEVDVSGLEIGDSLHA
SDLKLPPGVELAVSPEETIAAVVPPE
3D structure
PDB4v6a Formation of the first peptide bond: the structure of EF-P bound to the 70S ribosome.
ChainDZ
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna DZ K45 R79 I145 G146 E168 T169 P176 K44 R78 I144 G145 E167 T168 P175
BS02 rna DZ R9 P14 R18 Y28 N29 R30 N33 R71 Q72 N74 R78 E83 H84 F88 R8 P13 R17 Y27 N28 R29 N32 R70 Q71 N73 R77 E82 H83 F87
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v6a, PDBe:4v6a, PDBj:4v6a
PDBsum4v6a
PubMed19696344
UniProtQ5SHZ1|RL25_THET8 Large ribosomal subunit protein bL25 (Gene Name=rplY)

[Back to BioLiP]